SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vazb_ (5vaz B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2221844Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 2221845Superfamily e.13.1: DNA primase core [56731] (3 families) (S)
  5. 2289501Family e.13.1.0: automated matches [332802] (1 protein)
    not a true family
  6. 2289502Protein automated matches [332803] (1 species)
    not a true protein
  7. 2289503Species Pseudomonas aeruginosa [TaxId:208964] [332804] (1 PDB entry)
  8. 2289546Domain d5vazb_: 5vaz B: [332847]
    automated match to d1eqnc_
    complexed with so4

Details for d5vazb_

PDB Entry: 5vaz (more details), 2.4 Å

PDB Description: crystal structure of a dna primase domain from pseudomonas aeruginosa
PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d5vazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vazb_ e.13.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
plypllsaaaefykqalkshparkaavnylkgrgltgeiardfglgfappgwdnllkhlg
gdnlqlkamldagllvensdtgkrydrfrdrvmfpirdsrgriiafggrvlgddkpkyln
spetpvfhkgqelyglyearqknrdldeimvvegymdvialaqqgirnavatlgtatsee
hikrlfrlvpsilfcfdgdqagrkaawralesvlpnlqdgkrvrflflpegedpdslvra
egedafraritqqaqplaeyffqqlmleadpatlegkahlatlaapllekipgnnlrllm
rqrlseitglsgenigqlahh

SCOPe Domain Coordinates for d5vazb_:

Click to download the PDB-style file with coordinates for d5vazb_.
(The format of our PDB-style files is described here.)

Timeline for d5vazb_:

  • d5vazb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06