Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d5ja8d1: 5ja8 D:7-121 [332842] Other proteins in same PDB: d5ja8b2, d5ja8b3, d5ja8d2, d5ja8d3, d5ja8f2, d5ja8f3, d5ja8h2, d5ja8h3 automated match to d4dkaa_ complexed with act, edo, epe, pdo, po4 |
PDB Entry: 5ja8 (more details), 2.49 Å
SCOPe Domain Sequences for d5ja8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ja8d1 b.1.1.1 (D:7-121) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttnyadsvk grftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
Timeline for d5ja8d1: