Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (3 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
Protein automated matches [190935] (13 species) not a true protein |
Species Yersinia pestis [TaxId:632] [332774] (1 PDB entry) |
Domain d5v4dc1: 5v4d C:2-126 [332837] Other proteins in same PDB: d5v4da2, d5v4db2, d5v4dc2, d5v4dd2, d5v4de2, d5v4df2 automated match to d3v4da_ complexed with acy, ca, gol |
PDB Entry: 5v4d (more details), 1.6 Å
SCOPe Domain Sequences for d5v4dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v4dc1 d.79.1.0 (C:2-126) automated matches {Yersinia pestis [TaxId: 632]} ksvietknapsaigpysqaicfngilyasgqipinpdtgdlvendiekqtrqvlknidav llqagttkdkivkttifitninnssqvndiyadyfkgtifparstvevsalpkgalveie viagv
Timeline for d5v4dc1: