SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v4dc1 (5v4d C:2-126)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180206Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2180410Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2180411Protein automated matches [190935] (13 species)
    not a true protein
  7. 2289473Species Yersinia pestis [TaxId:632] [332774] (1 PDB entry)
  8. 2289536Domain d5v4dc1: 5v4d C:2-126 [332837]
    Other proteins in same PDB: d5v4da2, d5v4db2, d5v4dc2, d5v4dd2, d5v4de2, d5v4df2
    automated match to d3v4da_
    complexed with acy, ca, gol

Details for d5v4dc1

PDB Entry: 5v4d (more details), 1.6 Å

PDB Description: crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
PDB Compounds: (C:) Putative translational inhibitor protein

SCOPe Domain Sequences for d5v4dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v4dc1 d.79.1.0 (C:2-126) automated matches {Yersinia pestis [TaxId: 632]}
ksvietknapsaigpysqaicfngilyasgqipinpdtgdlvendiekqtrqvlknidav
llqagttkdkivkttifitninnssqvndiyadyfkgtifparstvevsalpkgalveie
viagv

SCOPe Domain Coordinates for d5v4dc1:

Click to download the PDB-style file with coordinates for d5v4dc1.
(The format of our PDB-style files is described here.)

Timeline for d5v4dc1:

  • d5v4dc1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06