SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ukka3 (5ukk A:550-667)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062184Species Human (Homo sapiens) [TaxId:9606] [186914] (52 PDB entries)
  8. 2289535Domain d5ukka3: 5ukk A:550-667 [332836]
    Other proteins in same PDB: d5ukka1, d5ukka2, d5ukkb_, d5ukkg_
    automated match to d3krwa3
    complexed with 8dj, mg

Details for d5ukka3

PDB Entry: 5ukk (more details), 2.6 Å

PDB Description: human grk2 in complex with human g-beta-gamma subunits and ccg211998 (14ak)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukka3 b.55.1.0 (A:550-667) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknk

SCOPe Domain Coordinates for d5ukka3:

Click to download the PDB-style file with coordinates for d5ukka3.
(The format of our PDB-style files is described here.)

Timeline for d5ukka3:

  • d5ukka3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06