Lineage for d5ukka3 (5ukk A:550-667)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062184Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2289535Domain d5ukka3: 5ukk A:550-667 [332836]
    Other proteins in same PDB: d5ukka1, d5ukka2, d5ukkb_, d5ukkg_
    automated match to d3krwa3
    complexed with 8dj, mg

Details for d5ukka3

PDB Entry: 5ukk (more details), 2.6 Å

PDB Description: human grk2 in complex with human g-beta-gamma subunits and ccg211998 (14ak)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukka3 b.55.1.0 (A:550-667) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknk

SCOPe Domain Coordinates for d5ukka3:

Click to download the PDB-style file with coordinates for d5ukka3.
(The format of our PDB-style files is described here.)

Timeline for d5ukka3:

  • d5ukka3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06