Lineage for d5ukka2 (5ukk A:186-549)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (16 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (646 PDB entries)
  8. 2289534Domain d5ukka2: 5ukk A:186-549 [332835]
    Other proteins in same PDB: d5ukka1, d5ukka3, d5ukkb_, d5ukkg_
    automated match to d3v5wa2
    complexed with 8dj, mg

Details for d5ukka2

PDB Entry: 5ukk (more details), 2.6 Å

PDB Description: human grk2 in complex with human g-beta-gamma subunits and ccg211998 (14ak)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukka2:

Sequence, based on SEQRES records: (download)

>d5ukka2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d5ukka2 d.144.1.7 (A:186-549) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafds
dqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknkqlgh

SCOPe Domain Coordinates for d5ukka2:

Click to download the PDB-style file with coordinates for d5ukka2.
(The format of our PDB-style files is described here.)

Timeline for d5ukka2:

  • d5ukka2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06