SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ukka1 (5ukk A:30-185)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002317Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2002318Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2002379Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2002380Protein automated matches [190464] (3 species)
    not a true protein
  7. 2002384Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2289533Domain d5ukka1: 5ukk A:30-185 [332834]
    Other proteins in same PDB: d5ukka2, d5ukka3, d5ukkb_, d5ukkg_
    automated match to d3v5wa1
    complexed with 8dj, mg

Details for d5ukka1

PDB Entry: 5ukk (more details), 2.6 Å

PDB Description: human grk2 in complex with human g-beta-gamma subunits and ccg211998 (14ak)
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5ukka1:

Sequence, based on SEQRES records: (download)

>d5ukka1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Sequence, based on observed residues (ATOM records): (download)

>d5ukka1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimfsksatehvqghlgkkqvppdlfqpyieeicqnlr
gdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5ukka1:

Click to download the PDB-style file with coordinates for d5ukka1.
(The format of our PDB-style files is described here.)

Timeline for d5ukka1:

  • d5ukka1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06