Lineage for d5v4da1 (5v4d A:2-126)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180206Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2180410Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2180411Protein automated matches [190935] (13 species)
    not a true protein
  7. 2289473Species Yersinia pestis [TaxId:632] [332774] (1 PDB entry)
  8. 2289529Domain d5v4da1: 5v4d A:2-126 [332830]
    Other proteins in same PDB: d5v4da2, d5v4db2, d5v4dc2, d5v4dd2, d5v4de2, d5v4df2
    automated match to d3v4da_
    complexed with acy, ca, gol

Details for d5v4da1

PDB Entry: 5v4d (more details), 1.6 Å

PDB Description: crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
PDB Compounds: (A:) Putative translational inhibitor protein

SCOPe Domain Sequences for d5v4da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v4da1 d.79.1.0 (A:2-126) automated matches {Yersinia pestis [TaxId: 632]}
ksvietknapsaigpysqaicfngilyasgqipinpdtgdlvendiekqtrqvlknidav
llqagttkdkivkttifitninnssqvndiyadyfkgtifparstvevsalpkgalveie
viagv

SCOPe Domain Coordinates for d5v4da1:

Click to download the PDB-style file with coordinates for d5v4da1.
(The format of our PDB-style files is described here.)

Timeline for d5v4da1:

  • d5v4da1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06