SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvja3 (5jvj A:516-874)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2289255Species Flaveria trinervia [TaxId:4227] [332556] (2 PDB entries)
  8. 2289524Domain d5jvja3: 5jvj A:516-874 [332825]
    Other proteins in same PDB: d5jvja1, d5jvja2, d5jvjb1, d5jvjb2
    automated match to d1vbga1
    complexed with mg, pep

Details for d5jvja3

PDB Entry: 5jvj (more details), 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvja3 c.1.12.0 (A:516-874) automated matches {Flaveria trinervia [TaxId: 4227]}
pamsndleifmswadqarrlkvmanadtpndaltarnngaqgiglcrtehmffasderik
avrkmimavtpeqrkvaldlllpyqrsdfegiframdglpvtirlldpplheflpegdle
hivnelavdtgmsadeiyskienlsevnpmlgfrgcrlgisypeltemqvraifqaavsm
tnqgvtvipeimvplvgtpqelrhqisvirgvaanvfaemgvtleykvgtmieipraali
aeeigkeadffsfgtndltqmtfgysrddvgkflqiylaqgilqhdpfevidqkgvgqli
kmatekgraanpslkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqviv

SCOPe Domain Coordinates for d5jvja3:

Click to download the PDB-style file with coordinates for d5jvja3.
(The format of our PDB-style files is described here.)

Timeline for d5jvja3:

  • d5jvja3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06