Lineage for d5jvja3 (5jvj A:516-874)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2289255Species Flaveria trinervia [TaxId:4227] [332556] (3 PDB entries)
  8. 2289524Domain d5jvja3: 5jvj A:516-874 [332825]
    Other proteins in same PDB: d5jvja1, d5jvja2, d5jvjb1, d5jvjb2
    automated match to d1vbga1
    complexed with mg, pep

Details for d5jvja3

PDB Entry: 5jvj (more details), 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvja3 c.1.12.0 (A:516-874) automated matches {Flaveria trinervia [TaxId: 4227]}
pamsndleifmswadqarrlkvmanadtpndaltarnngaqgiglcrtehmffasderik
avrkmimavtpeqrkvaldlllpyqrsdfegiframdglpvtirlldpplheflpegdle
hivnelavdtgmsadeiyskienlsevnpmlgfrgcrlgisypeltemqvraifqaavsm
tnqgvtvipeimvplvgtpqelrhqisvirgvaanvfaemgvtleykvgtmieipraali
aeeigkeadffsfgtndltqmtfgysrddvgkflqiylaqgilqhdpfevidqkgvgqli
kmatekgraanpslkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqviv

SCOPe Domain Coordinates for d5jvja3:

Click to download the PDB-style file with coordinates for d5jvja3.
(The format of our PDB-style files is described here.)

Timeline for d5jvja3:

  • d5jvja3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06