SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5un4a2 (5un4 A:67-128)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2181309Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2181310Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2181773Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2181774Protein automated matches [190903] (18 species)
    not a true protein
  7. 2289437Species Burkholderia lata [TaxId:482957] [332738] (1 PDB entry)
  8. 2289519Domain d5un4a2: 5un4 A:67-128 [332820]
    automated match to d4x1ch_

Details for d5un4a2

PDB Entry: 5un4 (more details), 1.49 Å

PDB Description: crystal structure of native fused 4-ot
PDB Compounds: (A:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d5un4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5un4a2 d.80.1.0 (A:67-128) automated matches {Burkholderia lata [TaxId: 482957]}
pvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggqtaral
gr

SCOPe Domain Coordinates for d5un4a2:

Click to download the PDB-style file with coordinates for d5un4a2.
(The format of our PDB-style files is described here.)

Timeline for d5un4a2:

  • d5un4a2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06