Lineage for d5uklg_ (5ukl G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012440Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2012441Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 protein domains)
  6. 2012442Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2012443Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries)
  8. 2289517Domain d5uklg_: 5ukl G: [332818]
    Other proteins in same PDB: d5ukla1, d5ukla2, d5ukla3, d5uklb_
    automated match to d1omwg_
    complexed with mg, six

Details for d5uklg_

PDB Entry: 5ukl (more details), 2.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg222886 (14bd)
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d5uklg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uklg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
ca

SCOPe Domain Coordinates for d5uklg_:

Click to download the PDB-style file with coordinates for d5uklg_.
(The format of our PDB-style files is described here.)

Timeline for d5uklg_:

  • d5uklg_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06