SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uklg_ (5ukl G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012440Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2012441Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 protein domains)
  6. 2012442Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2012443Species Cow (Bos taurus) [TaxId:9913] [48673] (27 PDB entries)
  8. 2289517Domain d5uklg_: 5ukl G: [332818]
    Other proteins in same PDB: d5ukla1, d5ukla2, d5ukla3, d5uklb_
    automated match to d1omwg_
    complexed with mg, six

Details for d5uklg_

PDB Entry: 5ukl (more details), 2.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg222886 (14bd)
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d5uklg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uklg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
ca

SCOPe Domain Coordinates for d5uklg_:

Click to download the PDB-style file with coordinates for d5uklg_.
(The format of our PDB-style files is described here.)

Timeline for d5uklg_:

  • d5uklg_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06