Lineage for d5vaza_ (5vaz A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2221844Fold e.13: DNA primase core [56730] (1 superfamily)
    2 domains: (1) alpha+beta; (2) toprim alpha/beta
  4. 2221845Superfamily e.13.1: DNA primase core [56731] (3 families) (S)
  5. 2289501Family e.13.1.0: automated matches [332802] (1 protein)
    not a true family
  6. 2289502Protein automated matches [332803] (1 species)
    not a true protein
  7. 2289503Species Pseudomonas aeruginosa [TaxId:208964] [332804] (1 PDB entry)
  8. 2289504Domain d5vaza_: 5vaz A: [332805]
    automated match to d1eqnc_
    complexed with so4

Details for d5vaza_

PDB Entry: 5vaz (more details), 2.4 Å

PDB Description: crystal structure of a dna primase domain from pseudomonas aeruginosa
PDB Compounds: (A:) DNA primase

SCOPe Domain Sequences for d5vaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vaza_ e.13.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
dsplypllsaaaefykqalkshparkaavnylkgrgltgeiardfglgfappgwdnllkh
lggdnlqlkamldagllvensdtgkrydrfrdrvmfpirdsrgriiafggrvlgddkpky
lnspetpvfhkgqelyglyearqknrdldeimvvegymdvialaqqgirnavatlgtats
eehikrlfrlvpsilfcfdgdqagrkaawralesvlpnlqdgkrvrflflpegedpdslv
raegedafraritqqaqplaeyffqqlmleadpatlegkahlatlaapllekipgnnlrl
lmrqrlseitglsgenigql

SCOPe Domain Coordinates for d5vaza_:

Click to download the PDB-style file with coordinates for d5vaza_.
(The format of our PDB-style files is described here.)

Timeline for d5vaza_:

  • d5vaza_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06