Lineage for d5ufra_ (5ufr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2289500Domain d5ufra_: 5ufr A: [332801]
    automated match to d3l0la_
    complexed with 88j

Details for d5ufra_

PDB Entry: 5ufr (more details), 2.07 Å

PDB Description: structure of rorgt bound to
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5ufra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufra_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq

SCOPe Domain Coordinates for d5ufra_:

Click to download the PDB-style file with coordinates for d5ufra_.
(The format of our PDB-style files is described here.)

Timeline for d5ufra_:

  • d5ufra_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06