SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vb8a1 (5vb8 A:1001-1219)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225430Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2225431Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2225550Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (3 protein domains)
    Pfam PF08016
  6. 2289494Protein automated matches [332795] (1 species)
    not a true protein
  7. 2289495Species Arcobacter butzleri [TaxId:28197] [332796] (1 PDB entry)
  8. 2289496Domain d5vb8a1: 5vb8 A:1001-1219 [332797]
    Other proteins in same PDB: d5vb8a2
    automated match to d3rvya_
    complexed with na, px4, so4

Details for d5vb8a1

PDB Entry: 5vb8 (more details), 2.85 Å

PDB Description: crystal structure of the navab voltage-gated sodium channel in an open state
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d5vb8a1:

Sequence, based on SEQRES records: (download)

>d5vb8a1 f.14.1.2 (A:1001-1219) automated matches {Arcobacter butzleri [TaxId: 28197]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvd

Sequence, based on observed residues (ATOM records): (download)

>d5vb8a1 f.14.1.2 (A:1001-1219) automated matches {Arcobacter butzleri [TaxId: 28197]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislveilrvlrvlrlfrlvtavpqmrkivsalisv
ipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsmgivrp
lmevypyawvffipfifvvtfvminlvvaicvd

SCOPe Domain Coordinates for d5vb8a1:

Click to download the PDB-style file with coordinates for d5vb8a1.
(The format of our PDB-style files is described here.)

Timeline for d5vb8a1:

  • d5vb8a1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5vb8a2