Lineage for d5vb8a1 (5vb8 A:1001-1219)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225430Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2225431Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2225550Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (3 protein domains)
    Pfam PF08016
  6. 2289494Protein automated matches [332795] (1 species)
    not a true protein
  7. 2289495Species Arcobacter butzleri [TaxId:28197] [332796] (1 PDB entry)
  8. 2289496Domain d5vb8a1: 5vb8 A:1001-1219 [332797]
    Other proteins in same PDB: d5vb8a2
    automated match to d3rvya_
    complexed with na, px4, so4

Details for d5vb8a1

PDB Entry: 5vb8 (more details), 2.85 Å

PDB Description: crystal structure of the navab voltage-gated sodium channel in an open state
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d5vb8a1:

Sequence, based on SEQRES records: (download)

>d5vb8a1 f.14.1.2 (A:1001-1219) automated matches {Arcobacter butzleri [TaxId: 28197]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvd

Sequence, based on observed residues (ATOM records): (download)

>d5vb8a1 f.14.1.2 (A:1001-1219) automated matches {Arcobacter butzleri [TaxId: 28197]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislveilrvlrvlrlfrlvtavpqmrkivsalisv
ipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsmgivrp
lmevypyawvffipfifvvtfvminlvvaicvd

SCOPe Domain Coordinates for d5vb8a1:

Click to download the PDB-style file with coordinates for d5vb8a1.
(The format of our PDB-style files is described here.)

Timeline for d5vb8a1:

  • d5vb8a1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5vb8a2