SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uvmb1 (5uvm B:2-114)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157192Protein Putative hydrolase [117791] (2 species)
  7. 2289488Species Ruminiclostridium thermocellum [TaxId:637887] [332789] (1 PDB entry)
  8. 2289489Domain d5uvmb1: 5uvm B:2-114 [332790]
    Other proteins in same PDB: d5uvma2, d5uvmb2
    automated match to d1xqub_
    complexed with adn, unx, zn

Details for d5uvmb1

PDB Entry: 5uvm (more details), 2.3 Å

PDB Description: hit family hydrolase from clostridium thermocellum cth-393
PDB Compounds: (B:) Histidine triad (HIT) protein

SCOPe Domain Sequences for d5uvmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uvmb1 d.13.1.1 (B:2-114) Putative hydrolase {Ruminiclostridium thermocellum [TaxId: 637887]}
encvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqil
idihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil

SCOPe Domain Coordinates for d5uvmb1:

Click to download the PDB-style file with coordinates for d5uvmb1.
(The format of our PDB-style files is described here.)

Timeline for d5uvmb1:

  • d5uvmb1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5uvmb2