Lineage for d5j13b1 (5j13 B:4-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (173 PDB entries)
  8. 2289485Domain d5j13b1: 5j13 B:4-112 [332786]
    Other proteins in same PDB: d5j13b2
    automated match to d1adql1
    complexed with so4

Details for d5j13b1

PDB Entry: 5j13 (more details), 2.3 Å

PDB Description: structural basis for tslp antagonism by the therapeutic antibody tezepelumab (medi9929 / amg-157)
PDB Compounds: (B:) anti-TSLP Fab-fragment, light chain

SCOPe Domain Sequences for d5j13b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j13b1 b.1.1.1 (B:4-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgqtaritcggnnlgsksvhwyqqkpgqapvlvvyddsdrpswiper
fsgsnsgntatltisrgeagdeadyycqvwdsssdhvvfgggtkltvlg

SCOPe Domain Coordinates for d5j13b1:

Click to download the PDB-style file with coordinates for d5j13b1.
(The format of our PDB-style files is described here.)

Timeline for d5j13b1:

  • d5j13b1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06