SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thbb_ (5thb B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (33 species)
    not a true protein
  7. 2239410Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2289480Domain d5thbb_: 5thb B: [332781]
    Other proteins in same PDB: d5thba_, d5thbc_, d5thbe_
    automated match to d3m5jb_
    complexed with bma, man, nag; mutant

Details for d5thbb_

PDB Entry: 5thb (more details), 2.41 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thbb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d5thbb_:

Click to download the PDB-style file with coordinates for d5thbb_.
(The format of our PDB-style files is described here.)

Timeline for d5thbb_:

  • d5thbb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06