SCOPe 2.07: Domain d5thbb_: 5thb B:

Lineage for d5thbb_ (5thb B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)

6. Protein automated matches [254646] (28 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)

8. Domain d5thbb_: 5thb B: [332781]
   Other proteins in same PDB: d5thba_, d5thbc_, d5thbe_
   automated match to d3m5jb_
   complexed with bma, man, nag; mutant

Details for d5thbb_

PDB Entry: 5thb, 2.41 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thbb_:

Sequence; same for both SEQRES and ATOM records:

>d5thbb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d5thbb_:

• d5thbb_ first appeared in SCOPe 2.06