Lineage for d5thbb_ (5thb B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (34 species)
    not a true protein
  7. 2239410Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2289480Domain d5thbb_: 5thb B: [332781]
    Other proteins in same PDB: d5thba_, d5thbc_, d5thbe_
    automated match to d3m5jb_
    complexed with bma, man, nag; mutant

Details for d5thbb_

PDB Entry: 5thb (more details), 2.41 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5thbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thbb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d5thbb_:

Click to download the PDB-style file with coordinates for d5thbb_.
(The format of our PDB-style files is described here.)

Timeline for d5thbb_:

  • d5thbb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06