SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5upxa1 (5upx A:1-486)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2289476Species Listeria monocytogenes [TaxId:169963] [332777] (1 PDB entry)
  8. 2289477Domain d5upxa1: 5upx A:1-486 [332778]
    Other proteins in same PDB: d5upxa2
    automated match to d4mz8b_
    complexed with gol, xmp

Details for d5upxa1

PDB Entry: 5upx (more details), 1.86 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from listeria monocytogenes in the presence of xanthosine monophosphate
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5upxa1:

Sequence, based on SEQRES records: (download)

>d5upxa1 c.1.5.0 (A:1-486) automated matches {Listeria monocytogenes [TaxId: 169963]}
mwetkfakegltfddvllvpaksdvlpndvdlsvemapslklnvpiwsagmdtiteakma
iaiarqggigvvhknmsieqqaeeiekvkrsesggikdiekviefpnsakdkhgrllaaa
avgitndtfvrveklieagvdaividtahghsagvinkiseirqtfkdvvivagnvatae
garalfevgvdivkvgigpgsicttrvvagvgvpqitaiydcatvarefgktiiadggik
ysgdivkalaaggnavmlgsmlagtdespgeteifqgrqfktyrgmgslaamehgskdry
fqadakklvpegiegrvpykgsvadiifqlvggirsgmgytgspdlrhlreeaafvrmtg
aglreshphdiqitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5upxa1 c.1.5.0 (A:1-486) automated matches {Listeria monocytogenes [TaxId: 169963]}
mwetkfakegltfddvllvpaksdvlpndvdlsvemapslklnvpiwsagmdtiteakma
iaiarqggigvvhknmsieqqaeeiekvkrsesggikdkviefpnsakdkhgrllaaaav
gitndtfvrveklieagvdaividtahghsagvinkiseirqtfkdvvivagnvataega
ralfevgvdivkvgigpgsicttrvvagvgvpqitaiydcatvarefgktiiadggikys
gdivkalaaggnavmlgsmlagtdespgeteifqgrqfktyrgmgslaamehgdryfqad
akklvpegiegrvpykgsvadiifqlvggirsgmgytgspdlrhlreeaafvrmtgaglr
eshphdiqitkeapnys

SCOPe Domain Coordinates for d5upxa1:

Click to download the PDB-style file with coordinates for d5upxa1.
(The format of our PDB-style files is described here.)

Timeline for d5upxa1:

  • d5upxa1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5upxa2