Lineage for d5upxa1 (5upx A:1-486)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2289476Species Listeria monocytogenes [TaxId:169963] [332777] (1 PDB entry)
  8. 2289477Domain d5upxa1: 5upx A:1-486 [332778]
    Other proteins in same PDB: d5upxa2
    automated match to d4mz8b_
    complexed with gol, xmp

Details for d5upxa1

PDB Entry: 5upx (more details), 1.86 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from listeria monocytogenes in the presence of xanthosine monophosphate
PDB Compounds: (A:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5upxa1:

Sequence, based on SEQRES records: (download)

>d5upxa1 c.1.5.0 (A:1-486) automated matches {Listeria monocytogenes [TaxId: 169963]}
mwetkfakegltfddvllvpaksdvlpndvdlsvemapslklnvpiwsagmdtiteakma
iaiarqggigvvhknmsieqqaeeiekvkrsesggikdiekviefpnsakdkhgrllaaa
avgitndtfvrveklieagvdaividtahghsagvinkiseirqtfkdvvivagnvatae
garalfevgvdivkvgigpgsicttrvvagvgvpqitaiydcatvarefgktiiadggik
ysgdivkalaaggnavmlgsmlagtdespgeteifqgrqfktyrgmgslaamehgskdry
fqadakklvpegiegrvpykgsvadiifqlvggirsgmgytgspdlrhlreeaafvrmtg
aglreshphdiqitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5upxa1 c.1.5.0 (A:1-486) automated matches {Listeria monocytogenes [TaxId: 169963]}
mwetkfakegltfddvllvpaksdvlpndvdlsvemapslklnvpiwsagmdtiteakma
iaiarqggigvvhknmsieqqaeeiekvkrsesggikdkviefpnsakdkhgrllaaaav
gitndtfvrveklieagvdaividtahghsagvinkiseirqtfkdvvivagnvataega
ralfevgvdivkvgigpgsicttrvvagvgvpqitaiydcatvarefgktiiadggikys
gdivkalaaggnavmlgsmlagtdespgeteifqgrqfktyrgmgslaamehgdryfqad
akklvpegiegrvpykgsvadiifqlvggirsgmgytgspdlrhlreeaafvrmtgaglr
eshphdiqitkeapnys

SCOPe Domain Coordinates for d5upxa1:

Click to download the PDB-style file with coordinates for d5upxa1.
(The format of our PDB-style files is described here.)

Timeline for d5upxa1:

  • d5upxa1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5upxa2