Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (34 species) not a true protein |
Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries) |
Domain d5th0a_: 5th0 A: [332773] Other proteins in same PDB: d5th0b_, d5th0d_, d5th0f_ automated match to d4d00c_ complexed with bma, man, nag; mutant |
PDB Entry: 5th0 (more details), 2.25 Å
SCOPe Domain Sequences for d5th0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5th0a_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]} dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnrrslmlatgmrnvpe
Timeline for d5th0a_: