SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ml5a_ (5ml5 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197409Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2197410Species Human (Homo sapiens) [TaxId:9606] [56130] (173 PDB entries)
  8. 2289461Domain d5ml5a_: 5ml5 A: [332762]
    automated match to d1kv1a_
    complexed with 1vi, bog

Details for d5ml5a_

PDB Entry: 5ml5 (more details), 1.9 Å

PDB Description: human p38alpha mapk in complex with imidazolyl pyridine inhibitor 11b
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d5ml5a_:

Sequence, based on SEQRES records: (download)

>d5ml5a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d5ml5a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
rptfyrqelnktiwevperyqnlspvgsygsvcaafdtktglrvavkklsrpfqsiihak
rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddh
vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnwmhy
nqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiq
sltfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqs
fesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d5ml5a_:

Click to download the PDB-style file with coordinates for d5ml5a_.
(The format of our PDB-style files is described here.)

Timeline for d5ml5a_:

  • d5ml5a_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06