SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thbc_ (5thb C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (29 species)
    not a true protein
  7. 2040964Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries)
  8. 2289452Domain d5thbc_: 5thb C: [332753]
    Other proteins in same PDB: d5thbb_, d5thbd_, d5thbf_
    automated match to d4d00c_
    complexed with bma, man, nag; mutant

Details for d5thbc_

PDB Entry: 5thb (more details), 2.41 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5thbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thbc_ b.19.1.0 (C:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpel

SCOPe Domain Coordinates for d5thbc_:

Click to download the PDB-style file with coordinates for d5thbc_.
(The format of our PDB-style files is described here.)

Timeline for d5thbc_:

  • d5thbc_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06