Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (34 species) not a true protein |
Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries) |
Domain d5tgvb_: 5tgv B: [332746] Other proteins in same PDB: d5tgva_, d5tgvc_, d5tgve_ automated match to d3m5jb_ complexed with bma, gal, nag, sia; mutant |
PDB Entry: 5tgv (more details), 2.97 Å
SCOPe Domain Sequences for d5tgvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tgvb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]} lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d5tgvb_: