SCOPe 2.06: Domain d5tgob_: 5tgo B:

Lineage for d5tgob_ (5tgo B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)

8. Domain d5tgob_: 5tgo B: [332745]
   Other proteins in same PDB: d5tgoa_, d5tgoc_, d5tgoe_
   automated match to d3m5jb_
   complexed with bma, man, nag; mutant

Details for d5tgob_

PDB Entry: 5tgo, 2.35 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5tgob_:

Sequence; same for both SEQRES and ATOM records:

>d5tgob_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d5tgob_:

• d5tgob_ is new in SCOPe 2.06-stable
  
• d5tgob_ appears in SCOPe 2.07
  
• d5tgob_ appears in the current release, SCOPe 2.08