Lineage for d5tgob_ (5tgo B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (34 species)
    not a true protein
  7. 2239410Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2289444Domain d5tgob_: 5tgo B: [332745]
    Other proteins in same PDB: d5tgoa_, d5tgoc_, d5tgoe_
    automated match to d3m5jb_
    complexed with bma, man, nag; mutant

Details for d5tgob_

PDB Entry: 5tgo (more details), 2.35 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5tgob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgob_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d5tgob_:

Click to download the PDB-style file with coordinates for d5tgob_.
(The format of our PDB-style files is described here.)

Timeline for d5tgob_:

  • d5tgob_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06