SCOPe 2.06: Domain d5tgoe_: 5tgo E:

Lineage for d5tgoe_ (5tgo E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries)

8. Domain d5tgoe_: 5tgo E: [332743]
   Other proteins in same PDB: d5tgob_, d5tgod_, d5tgof_
   automated match to d4d00c_
   complexed with bma, man, nag; mutant

Details for d5tgoe_

PDB Entry: 5tgo, 2.35 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5tgoe_:

Sequence; same for both SEQRES and ATOM records:

>d5tgoe_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

Timeline for d5tgoe_:

• d5tgoe_ is new in SCOPe 2.06-stable
  
• d5tgoe_ appears in SCOPe 2.07
  
• d5tgoe_ appears in the current release, SCOPe 2.08