Lineage for d5k7sa_ (5k7s A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2114990Protein Proteinase K [52762] (1 species)
  7. 2114991Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (39 PDB entries)
    Uniprot P06873
  8. 2289440Domain d5k7sa_: 5k7s A: [332741]
    automated match to d2prka_
    complexed with ca

Details for d5k7sa_

PDB Entry: 5k7s (more details), 1.6 Å

PDB Description: microed structure of proteinase k at 1.6 a resolution
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d5k7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k7sa_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d5k7sa_:

Click to download the PDB-style file with coordinates for d5k7sa_.
(The format of our PDB-style files is described here.)

Timeline for d5k7sa_:

  • d5k7sa_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06