Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) |
Domain d5ja9b1: 5ja9 B:2-117 [332735] Other proteins in same PDB: d5ja9a2, d5ja9b2 automated match to d5h8da_ complexed with edo, so4 |
PDB Entry: 5ja9 (more details), 1.85 Å
SCOPe Domain Sequences for d5ja9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ja9b1 b.1.1.1 (B:2-117) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvs
Timeline for d5ja9b1: