Lineage for d5ja9b1 (5ja9 B:2-117)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (134 PDB entries)
  8. 2289434Domain d5ja9b1: 5ja9 B:2-117 [332735]
    Other proteins in same PDB: d5ja9a2, d5ja9b2
    automated match to d5h8da_
    complexed with edo, so4

Details for d5ja9b1

PDB Entry: 5ja9 (more details), 1.85 Å

PDB Description: crystal structure of the higb2 toxin in complex with nb6
PDB Compounds: (B:) Nanobody 6

SCOPe Domain Sequences for d5ja9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja9b1 b.1.1.1 (B:2-117) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvs

SCOPe Domain Coordinates for d5ja9b1:

Click to download the PDB-style file with coordinates for d5ja9b1.
(The format of our PDB-style files is described here.)

Timeline for d5ja9b1:

  • d5ja9b1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5ja9b2