SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mj6b3 (5mj6 B:616-706)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033616Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2033638Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2033639Protein automated matches [254707] (4 species)
    not a true protein
  7. 2033640Species Human (Homo sapiens) [TaxId:9606] [255965] (15 PDB entries)
  8. 2289431Domain d5mj6b3: 5mj6 B:616-706 [332732]
    Other proteins in same PDB: d5mj6a1, d5mj6a2, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b2, d5mj6b4, d5mj6b5
    automated match to d4pj6a3
    complexed with 7o2, bma, br, man, nag, zn

Details for d5mj6b3

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6b3:

Sequence, based on SEQRES records: (download)

>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records): (download)

>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnsylwhiplsyvtegrnyskyqsvslldkksgvinlte
evlwvkvninmngyyivhyad

SCOPe Domain Coordinates for d5mj6b3:

Click to download the PDB-style file with coordinates for d5mj6b3.
(The format of our PDB-style files is described here.)

Timeline for d5mj6b3:

  • d5mj6b3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06