SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mj6b2 (5mj6 B:367-615)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184728Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2184729Protein automated matches [190805] (16 species)
    not a true protein
  7. 2184748Species Human (Homo sapiens) [TaxId:9606] [188286] (40 PDB entries)
  8. 2289430Domain d5mj6b2: 5mj6 B:367-615 [332731]
    Other proteins in same PDB: d5mj6a1, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b3, d5mj6b4, d5mj6b5
    automated match to d4pj6a2
    complexed with 7o2, bma, br, man, nag, zn

Details for d5mj6b2

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mj6b2 d.92.1.0 (B:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg

SCOPe Domain Coordinates for d5mj6b2:

Click to download the PDB-style file with coordinates for d5mj6b2.
(The format of our PDB-style files is described here.)

Timeline for d5mj6b2:

  • d5mj6b2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06