Lineage for d5mj6b1 (5mj6 B:160-366)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085522Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2085523Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2085607Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2085608Protein automated matches [254706] (5 species)
    not a true protein
  7. 2085612Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries)
  8. 2085627Domain d5mj6b1: 5mj6 B:160-366 [332730]
    Other proteins in same PDB: d5mj6a2, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b2, d5mj6b3, d5mj6b4, d5mj6b5
    automated match to d4pj6a1
    complexed with 7o2, bma, br, man, nag, zn

Details for d5mj6b1

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mj6b1 b.98.1.0 (B:160-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisrv
tfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy
tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl
ddglvqdefsesvkmstylvafivgem

SCOPe Domain Coordinates for d5mj6b1:

Click to download the PDB-style file with coordinates for d5mj6b1.
(The format of our PDB-style files is described here.)

Timeline for d5mj6b1: