Class b: All beta proteins [48724] (177 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries) |
Domain d5mj6b1: 5mj6 B:160-366 [332730] Other proteins in same PDB: d5mj6a2, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b2, d5mj6b3, d5mj6b4, d5mj6b5 automated match to d4pj6a1 complexed with 7o2, bma, br, man, nag, zn |
PDB Entry: 5mj6 (more details), 2.53 Å
SCOPe Domain Sequences for d5mj6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mj6b1 b.98.1.0 (B:160-366) automated matches {Human (Homo sapiens) [TaxId: 9606]} lfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisrv tfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl ddglvqdefsesvkmstylvafivgem
Timeline for d5mj6b1: