Lineage for d5thbe_ (5thb E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776708Domain d5thbe_: 5thb E: [332727]
    Other proteins in same PDB: d5thbb_, d5thbd_, d5thbf_
    automated match to d4d00c_
    complexed with nag; mutant

Details for d5thbe_

PDB Entry: 5thb (more details), 2.41 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (t193d-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5thbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thbe_ b.19.1.0 (E:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekntlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d5thbe_:

Click to download the PDB-style file with coordinates for d5thbe_.
(The format of our PDB-style files is described here.)

Timeline for d5thbe_: