SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mqvf_ (5mqv F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2196104Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2196110Species Human (Homo sapiens) [TaxId:9606] [224941] (13 PDB entries)
  8. 2289425Domain d5mqvf_: 5mqv F: [332726]
    automated match to d1ckia_
    complexed with d5q, po4

Details for d5mqvf_

PDB Entry: 5mqv (more details), 2.15 Å

PDB Description: crystal structure of human casein kinase i delta in complex with 4-(2, 5-dimethoxyphenyl)-n-(4-(5-(4-fluorphenyl)-2-(methylthio)-1h- imidazol-4-yl)-pyridin-2-yl)-1-methyl-1h-pyrrole-2-carboxamide
PDB Compounds: (F:) Casein kinase I isoform delta

SCOPe Domain Sequences for d5mqvf_:

Sequence, based on SEQRES records: (download)

>d5mqvf_ d.144.1.7 (F:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
rdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthl
gieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgyps
efatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk

Sequence, based on observed residues (ATOM records): (download)

>d5mqvf_ d.144.1.7 (F:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
rdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthl
gieqsrrddleslgyvlmyfnlgslpwqglatkrqkyerisekkmstpievlckgypsef
atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk

SCOPe Domain Coordinates for d5mqvf_:

Click to download the PDB-style file with coordinates for d5mqvf_.
(The format of our PDB-style files is described here.)

Timeline for d5mqvf_:

  • d5mqvf_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06