Lineage for d5n0ib1 (5n0i B:33-270)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2206129Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2206130Protein automated matches [190418] (18 species)
    not a true protein
  7. 2206156Species Klebsiella pneumoniae [TaxId:573] [189718] (36 PDB entries)
  8. 2289417Domain d5n0ib1: 5n0i B:33-270 [332718]
    Other proteins in same PDB: d5n0ia2, d5n0ib2
    automated match to d4eyba_
    complexed with bme, cl, gol, pg4, zn

Details for d5n0ib1

PDB Entry: 5n0i (more details), 1.47 Å

PDB Description: crystal structure of ndm-1 in complex with beta-mercaptoethanol - new refinement
PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5n0ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n0ib1 d.157.1.0 (B:33-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdta
wtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqe
gmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikd
skakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5n0ib1:

Click to download the PDB-style file with coordinates for d5n0ib1.
(The format of our PDB-style files is described here.)

Timeline for d5n0ib1:

  • d5n0ib1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5n0ib2