SCOPe 2.06: Domain d5n0ha1: 5n0h A:41-270

Lineage for d5n0ha1 (5n0h A:41-270)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)

8. Domain d5n0ha1: 5n0h A:41-270 [332715]
   Other proteins in same PDB: d5n0ha2, d5n0hb2
   automated match to d4eyba_
   complexed with 8fb, gol, so4, zn

Details for d5n0ha1

PDB Entry: 5n0h, 1.9 Å

PDB Description: crystal structure of ndm-1 in complex with hydrolyzed meropenem - new refinement

PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5n0ha1:

Sequence; same for both SEQRES and ATOM records:

>d5n0ha1 d.157.1.0 (A:41-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d5n0ha1:

• d5n0ha1 is new in SCOPe 2.06-stable
  
• d5n0ha1 appears in SCOPe 2.07
  
• d5n0ha1 appears in the current release, SCOPe 2.08