SCOPe 2.07: Domain d5mj6a2: 5mj6 A:367-615

Lineage for d5mj6a2 (5mj6 A:367-615)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)

8. Domain d5mj6a2: 5mj6 A:367-615 [332703]
   Other proteins in same PDB: d5mj6a1, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b3, d5mj6b4, d5mj6b5
   automated match to d4pj6a2
   complexed with 7o2, bma, br, man, nag, zn

Details for d5mj6a2

PDB Entry: 5mj6, 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.

PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6a2:

Sequence; same for both SEQRES and ATOM records:

>d5mj6a2 d.92.1.0 (A:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg

Timeline for d5mj6a2:

• d5mj6a2 first appeared in SCOPe 2.06
  
• d5mj6a2 appears in the current release, SCOPe 2.08