Lineage for d5mj6a2 (5mj6 A:367-615)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964907Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)
  8. 2964999Domain d5mj6a2: 5mj6 A:367-615 [332703]
    Other proteins in same PDB: d5mj6a1, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b3, d5mj6b4, d5mj6b5
    automated match to d4pj6a2
    complexed with 7o2, br, nag, zn

Details for d5mj6a2

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mj6a2 d.92.1.0 (A:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg

SCOPe Domain Coordinates for d5mj6a2:

Click to download the PDB-style file with coordinates for d5mj6a2.
(The format of our PDB-style files is described here.)

Timeline for d5mj6a2: