SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mj6a1 (5mj6 A:157-366)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074713Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2074714Protein automated matches [254706] (5 species)
    not a true protein
  7. 2074718Species Human (Homo sapiens) [TaxId:9606] [255964] (16 PDB entries)
  8. 2289401Domain d5mj6a1: 5mj6 A:157-366 [332702]
    Other proteins in same PDB: d5mj6a2, d5mj6a3, d5mj6a4, d5mj6a5, d5mj6b2, d5mj6b3, d5mj6b4, d5mj6b5
    automated match to d4pj6a1
    complexed with 7o2, bma, br, man, nag, zn

Details for d5mj6a1

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mj6a1 b.98.1.0 (A:157-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghni
srvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfyg
fsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkss
vvlddglvqdefsesvkmstylvafivgem

SCOPe Domain Coordinates for d5mj6a1:

Click to download the PDB-style file with coordinates for d5mj6a1.
(The format of our PDB-style files is described here.)

Timeline for d5mj6a1:

  • d5mj6a1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06