Lineage for d5mx4b_ (5mx4 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2141939Species Helicobacter pylori [TaxId:1145110] [332679] (1 PDB entry)
  8. 2141941Domain d5mx4b_: 5mx4 B: [332699]
    automated match to d4m3na_
    complexed with hpa, po4

Details for d5mx4b_

PDB Entry: 5mx4 (more details), 2.31 Å

PDB Description: crystal structure of h. pylori purine nucleoside phosphorylase from clinical isolate hppnp-1
PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d5mx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx4b_ c.56.2.0 (B:) automated matches {Helicobacter pylori [TaxId: 1145110]}
mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgkgislm
ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
lnhdlsatpdfelslrayqtakrlgidlkignvfssdffysfethafdlmaqynhlaiem
eaaglyatamelnakalclcsvsdhlitkealspkeriesfdnmiilalemms

SCOPe Domain Coordinates for d5mx4b_:

Click to download the PDB-style file with coordinates for d5mx4b_.
(The format of our PDB-style files is described here.)

Timeline for d5mx4b_: