SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ja9a1 (5ja9 A:2-117)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (128 PDB entries)
  8. 2289392Domain d5ja9a1: 5ja9 A:2-117 [332693]
    Other proteins in same PDB: d5ja9a2, d5ja9b2
    automated match to d5h8da_
    complexed with edo, so4

Details for d5ja9a1

PDB Entry: 5ja9 (more details), 1.85 Å

PDB Description: crystal structure of the higb2 toxin in complex with nb6
PDB Compounds: (A:) Nanobody 6

SCOPe Domain Sequences for d5ja9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja9a1 b.1.1.1 (A:2-117) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvs

SCOPe Domain Coordinates for d5ja9a1:

Click to download the PDB-style file with coordinates for d5ja9a1.
(The format of our PDB-style files is described here.)

Timeline for d5ja9a1:

  • d5ja9a1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5ja9a2