Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83331] [332690] (1 PDB entry) |
Domain d5jz9b_: 5jz9 B: [332691] automated match to d2vf2a_ complexed with 6or |
PDB Entry: 5jz9 (more details), 2.68 Å
SCOPe Domain Sequences for d5jz9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jz9b_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]} ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnslgggtavrfald yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflggg
Timeline for d5jz9b_: