SCOPe 2.06: Domain d5jz9b_: 5jz9 B:

Lineage for d5jz9b_ (5jz9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83331] [332690] (1 PDB entry)

8. Domain d5jz9b_: 5jz9 B: [332691]
   automated match to d2vf2a_
   complexed with 6or

Details for d5jz9b_

PDB Entry: 5jz9, 2.68 Å

PDB Description: crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid

PDB Compounds: (B:) 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase

SCOPe Domain Sequences for d5jz9b_:

Sequence; same for both SEQRES and ATOM records:

>d5jz9b_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnslgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflggg

Timeline for d5jz9b_:

• d5jz9b_ is new in SCOPe 2.06-stable
  
• d5jz9b_ appears in SCOPe 2.07
  
• d5jz9b_ appears in the current release, SCOPe 2.08