SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jz9b_ (5jz9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (85 species)
    not a true protein
  7. 2289389Species Mycobacterium tuberculosis [TaxId:83331] [332690] (1 PDB entry)
  8. 2289390Domain d5jz9b_: 5jz9 B: [332691]
    automated match to d2vf2a_
    complexed with 6or

Details for d5jz9b_

PDB Entry: 5jz9 (more details), 2.68 Å

PDB Description: crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid
PDB Compounds: (B:) 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase

SCOPe Domain Sequences for d5jz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jz9b_ c.69.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnslgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflggg

SCOPe Domain Coordinates for d5jz9b_:

Click to download the PDB-style file with coordinates for d5jz9b_.
(The format of our PDB-style files is described here.)

Timeline for d5jz9b_:

  • d5jz9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06