SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhda3 (5lhd A:549-636)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033616Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2033638Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2033639Protein automated matches [254707] (4 species)
    not a true protein
  7. 2033640Species Human (Homo sapiens) [TaxId:9606] [255965] (15 PDB entries)
  8. 2289385Domain d5lhda3: 5lhd A:549-636 [332686]
    Other proteins in same PDB: d5lhda1, d5lhda2, d5lhda4, d5lhdb1, d5lhdb2, d5lhdb4, d5lhdc1, d5lhdc2, d5lhdc4, d5lhdd1, d5lhdd2, d5lhdd4
    automated match to d4fyta3
    complexed with bma, edo, nag, zn

Details for d5lhda3

PDB Entry: 5lhd (more details), 2.6 Å

PDB Description: structure of glycosylated human aminopeptidase n
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5lhda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhda3 b.1.30.0 (A:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq
ndlfstsgnewvllnlnvtgyyrvnyde

SCOPe Domain Coordinates for d5lhda3:

Click to download the PDB-style file with coordinates for d5lhda3.
(The format of our PDB-style files is described here.)

Timeline for d5lhda3:

  • d5lhda3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06