Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
Domain d5lhda1: 5lhd A:63-287 [332684] Other proteins in same PDB: d5lhda2, d5lhda3, d5lhda4, d5lhdb2, d5lhdb3, d5lhdb4, d5lhdc2, d5lhdc3, d5lhdc4, d5lhdd2, d5lhdd3, d5lhdd4 automated match to d4fyqa1 complexed with edo, nag, zn |
PDB Entry: 5lhd (more details), 2.6 Å
SCOPe Domain Sequences for d5lhda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhda1 b.98.1.0 (A:63-287) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviii hskklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsef egeladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkd ltalsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef
Timeline for d5lhda1: