Lineage for d5k7ta_ (5k7t A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2183667Family d.92.1.2: Thermolysin-like [55490] (5 protein domains)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2183681Protein Thermolysin [63414] (3 species)
  7. 2183682Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (172 PDB entries)
    Uniprot P00800
  8. 2289380Domain d5k7ta_: 5k7t A: [332681]
    automated match to d1kkka_
    complexed with ca, dms, ipa, zn

Details for d5k7ta_

PDB Entry: 5k7t (more details), 2.5 Å

PDB Description: microed structure of thermolysin at 2.5 a resolution
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5k7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k7ta_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5k7ta_:

Click to download the PDB-style file with coordinates for d5k7ta_.
(The format of our PDB-style files is described here.)

Timeline for d5k7ta_:

  • d5k7ta_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06