Lineage for d5ksvb1 (5ksv B:3-92)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507607Domain d5ksvb1: 5ksv B:3-92 [332676]
    Other proteins in same PDB: d5ksva2, d5ksvb2
    automated match to d1klub2

Details for d5ksvb1

PDB Entry: 5ksv (more details), 2.2 Å

PDB Description: crystal structure of hla-dq2.5-clip2
PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ksvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksvb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

SCOPe Domain Coordinates for d5ksvb1:

Click to download the PDB-style file with coordinates for d5ksvb1.
(The format of our PDB-style files is described here.)

Timeline for d5ksvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ksvb2