![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (18 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [189718] (39 PDB entries) |
![]() | Domain d5n0ia1: 5n0i A:41-270 [332673] Other proteins in same PDB: d5n0ia2, d5n0ib2 automated match to d4eyba_ complexed with bme, cl, gol, pg4, zn |
PDB Entry: 5n0i (more details), 1.47 Å
SCOPe Domain Sequences for d5n0ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n0ia1 d.157.1.0 (A:41-270) automated matches {Klebsiella pneumoniae [TaxId: 573]} tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d5n0ia1: