SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n0ia1 (5n0i A:41-270)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2206129Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2206130Protein automated matches [190418] (18 species)
    not a true protein
  7. 2206156Species Klebsiella pneumoniae [TaxId:573] [189718] (35 PDB entries)
  8. 2289372Domain d5n0ia1: 5n0i A:41-270 [332673]
    Other proteins in same PDB: d5n0ia2, d5n0ib2
    automated match to d4eyba_
    complexed with bme, cl, gol, pg4, zn

Details for d5n0ia1

PDB Entry: 5n0i (more details), 1.47 Å

PDB Description: crystal structure of ndm-1 in complex with beta-mercaptoethanol - new refinement
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5n0ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n0ia1 d.157.1.0 (A:41-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5n0ia1:

Click to download the PDB-style file with coordinates for d5n0ia1.
(The format of our PDB-style files is described here.)

Timeline for d5n0ia1:

  • d5n0ia1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5n0ia2