SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5luda_ (5lud A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064271Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2064272Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2064273Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2064274Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2064289Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (113 PDB entries)
    Uniprot P05092
  8. 2289368Domain d5luda_: 5lud A: [332669]
    automated match to d1w8ma_
    complexed with 76x

Details for d5luda_

PDB Entry: 5lud (more details), 1.25 Å

PDB Description: structure of cyclophilin a in complex with 2,3-diaminopyridine
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d5luda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5luda_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d5luda_:

Click to download the PDB-style file with coordinates for d5luda_.
(The format of our PDB-style files is described here.)

Timeline for d5luda_:

  • d5luda_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06