SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mwjb1 (5mwj B:443-770)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066038Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 2066039Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. 2289362Domain d5mwjb1: 5mwj B:443-770 [332663]
    Other proteins in same PDB: d5mwja2, d5mwjb2
    automated match to d1gxra_
    complexed with dms, ebu

Details for d5mwjb1

PDB Entry: 5mwj (more details), 2.04 Å

PDB Description: structure enabled discovery of a stapled peptide inhibitor to target the oncogenic transcriptional repressor tle1
PDB Compounds: (B:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d5mwjb1:

Sequence, based on SEQRES records: (download)

>d5mwjb1 b.69.4.1 (B:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci
disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve
vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv
lscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d5mwjb1 b.69.4.1 (B:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytggkgcv
kvwdiskspvsqldclnrdnyirsckllpdgctlivggeastlsiwdltprikaeltssa
pacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidisgtklwtggl
dntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevlhvnkpdkyqlhl
hescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscdisvddkyivt
gsgdkkatvyeviy

SCOPe Domain Coordinates for d5mwjb1:

Click to download the PDB-style file with coordinates for d5mwjb1.
(The format of our PDB-style files is described here.)

Timeline for d5mwjb1:

  • d5mwjb1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5mwjb2