SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mtjb_ (5mtj B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029908Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2029909Protein automated matches [190976] (4 species)
    not a true protein
  7. 2029933Species Human (Homo sapiens) [TaxId:9606] [188649] (50 PDB entries)
  8. 2289357Domain d5mtjb_: 5mtj B: [332658]
    Other proteins in same PDB: d5mtja_
    automated match to d3uyod_
    complexed with cxs, so4

Details for d5mtjb_

PDB Entry: 5mtj (more details), 1.95 Å

PDB Description: yes1-sh2 in complex with monobody mb(yes_1)
PDB Compounds: (B:) Monobody Mb(Yes_1)

SCOPe Domain Sequences for d5mtjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mtjb_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vssvptklevvaatptslliswdapavtvdyyfitygetggnspvqeftvpgskstatis
glkpgvdytitvyawyyyddeyymnesspisinyrt

SCOPe Domain Coordinates for d5mtjb_:

Click to download the PDB-style file with coordinates for d5mtjb_.
(The format of our PDB-style files is described here.)

Timeline for d5mtjb_:

  • d5mtjb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06