Lineage for d5mtjb_ (5mtj B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029908Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2029909Protein automated matches [190976] (4 species)
    not a true protein
  7. 2029933Species Human (Homo sapiens) [TaxId:9606] [188649] (50 PDB entries)
  8. 2289357Domain d5mtjb_: 5mtj B: [332658]
    Other proteins in same PDB: d5mtja_
    automated match to d3uyod_
    complexed with cxs, so4

Details for d5mtjb_

PDB Entry: 5mtj (more details), 1.95 Å

PDB Description: yes1-sh2 in complex with monobody mb(yes_1)
PDB Compounds: (B:) Monobody Mb(Yes_1)

SCOPe Domain Sequences for d5mtjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mtjb_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vssvptklevvaatptslliswdapavtvdyyfitygetggnspvqeftvpgskstatis
glkpgvdytitvyawyyyddeyymnesspisinyrt

SCOPe Domain Coordinates for d5mtjb_:

Click to download the PDB-style file with coordinates for d5mtjb_.
(The format of our PDB-style files is described here.)

Timeline for d5mtjb_:

  • d5mtjb_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06